PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00701.20
Common NameJCGZ_12346, LOC105639663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 350aa    MW: 39847.1 Da    PI: 7.1423
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00701.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.9e-33223278156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Jcr4S00701.20 223 KQRRCWSPELHRRFVDALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 278
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.37E-19221281IPR009057Homeodomain-like
PROSITE profilePS5129412.421222280IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-30222281IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-27223278IPR006447Myb domain, plants
PfamPF002494.0E-8225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MELSLDLSLV YVPKTISEYL KEVSKVKDAS LRLSKLDDFV KRLEDEMRKI DAFKRELPLC  60
MLLLNDAIVK LKEEAMQCKR SKDPVPVKGN SGKDDISDKK NWMSSVQLWN SNDIDFNSKK  120
QDSISEIRQK SEEEDDRSTC ENPIQLCNSR SKRGAFVPFK AISGFEGTER KEEKEVMSQV  180
TGLSLMTPVP ELGTCNLMSK SNNVTNQMKI QSKPHQQQQP YKKQRRCWSP ELHRRFVDAL  240
QQLGGSQVAT PKQIRELMQV DGLTNDEVKS HLQKYRLHIR KLPASSAAQA NALWLAKCED  300
SSKPNISESA KDISSTGDDS MDVVDDNDDN KSESHSWNGR LHHKEGEFDV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079174.10.0PREDICTED: uncharacterized protein LOC105639663 isoform X1
TrEMBLA0A067KHZ00.0A0A067KHZ0_JATCU; Uncharacterized protein
STRINGPOPTR_0007s11470.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-73G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]